LOG-IN
Displaying reports 2701-2720 of 3200.Go to page Start 132 133 134 135 136 137 138 139 140 End
R&D (FilterCavity)
Print this report.
MarcEisenmann - 19:30, Friday 28 July 2017 (541)Get code to link to this report
Mode cleaner finesse
Today we measured the Mode Cleaner transmission.

To access to the MC finesse, we tried to use the following fit : T0/ ( 1 + 4R / (1-R)² * sin² ( pi (x-x0)/FSR ) ) + bg
Attached to this report are two results we could get : one without normalization, one with normalization.

By using Finesse = 4R / (1-R)², we could get the following results :
First case : 209
Second case (with normalization) : 360

By checking the ratio FSR over peak width : Finesse = 150.

We will try to undestand better how to fit this function
Images attached to this report
541_20170728122118_65.bmp 541_20170728122133_finessemax1.bmp
R&D (FilterCavity)
Print this report.
MarcEisenmann - 19:16, Friday 28 July 2017 (540)Get code to link to this report
End mirror control drift and ventilation system
Yesterday, when we locked the cavity, we had to set the local control of the pitch of the end mirror at -4.8 (on a scale from 5 to -5).
Today, it was not possible to lock the cavity because of a drift of the end mirror.

When we went to the end room to reset the local control, the temperature and humidity of the end room was quite high.
It appears that a air ventilation system was off. As soon as we turned it on, it started to feel more confortable.

After resetting the end mirror local control, it was possible to lock the cavity again.
KAGRA MIR (Absorption)
Print this report.
ManuelMarchio - 17:27, Friday 28 July 2017 (539)Get code to link to this report
1310nm laser probe and Imaging unit installed

I installed the 1310nm laser and the relative Imaging Unit 

items:

- Laser controller

- fiber output

- golden half-inch mirror

- golden small prism mirror (before the cross point)

On the Imaging unit translation stage:

- golden large prism mirror (after the cross point)

- XY lens mount

- coated half ball

- Photo Detector

Images attached to this report
539_20170728102651_screenshotfrom20170728172733.png 539_20170728102656_screenshotfrom20170728172714.png 539_20170728102700_screenshotfrom20170728172636.png
R&D (FilterCavity)
Print this report.
MarcEisenmann - 19:22, Wednesday 26 July 2017 (538)Get code to link to this report
Tranfer Functions
Here are the Transfer Functions we could get last Monday.

The Spectrum Analyzer provided data in ".DAT" file.
By using a program provided by Tatsumi-san, we were able to convert these data in ".DOT" file and then use Matlab to plot them.

This ".DOT" file is divided in 3 columns : frequency, magnitude and phase of the transfer function.

Attached to this entry are the open-loop, the electronic-loop and the optical loop.
They seem to be coherent with what the spectrum analyzer displayed during the measurement.
Images attached to this report
538_20170726122026_electroniclooptfvpp30mv.bmp 538_20170726122051_openlooptfvpp60mv.bmp 538_20170726122109_opticlooptfvpp1mv.bmp
R&D (FilterCavity)
Print this report.
YuefanGuo - 17:56, Wednesday 26 July 2017 (537)Get code to link to this report
AOM simulation test
Since we discovered there is no other solutions to let the AOM works except change the lens, so at first we did a test on the transmission of the MZ beam splitter. Then we will copy this configuration to real path, install the AOM and align the cavity again.

Before install everything, we checked the beam size after the transmission of the beam splitter, which is the same at the reflection. Take the origin at the front surface of the beam splitter, the beam waist is at -9.72cm, size is 53.36um. Then the first lens we use is 100mm, 5cm from the origin, but at the focal plane the beam diameter is larger than 1.3mm, which is the maximum the AOM can work according to the data sheet. So the AOM was put around 11cm, connected with the power, the AOM shows very clear diffraction orders.

Then another 100mm lens was put at 25cm. After putting this lens, we did some measurement of the beam size, and found the position to put the third lens in order to have a good size at the 2inch mirror of the telescope(less than 1.3mm). The third lens is 175mm, was put at 48.5cm. Then we checked the beam shape far, there is no obvious astigmatism as far as we can see. Measuring the beam again and we got the result that the beam at 2 inch mirror should be less than 1.2mm.

But then we found out if we want to change the MZ design and put another beam splitter after the one we have now, the first 100mm lens should be put further to give enough space to the BS. With Jammt, I did the simulation and found out if we move everything together 2.5cm further from the position mentioned before, the 175mm lens was not capable to focus the beam enough on the 2inch mirror. I tried other focal length, the 200mm should work.

The other problem is after moving(pic 1), the beam after the first lens will diverge more compared to the previous design(pic 2),sSince the two green dash lines in two pictures have the same distance. Divergence of the beam is one of the question we concern most, so I checked on the bench, after changing the AOM still works well.

It seems this new configuration is acceptable, we are going to install another beam splitter first and start to change the lenses.


Images attached to this report
537_20170726105123_5cmreal.png 537_20170726105134_5cm.png
R&D (FilterCavity)
Print this report.
EleonoraCapocasa - 07:43, Wednesday 26 July 2017 (536)Get code to link to this report
Comment to Filter cavity locking loop characterization (Click here to view original report: 412)

The amplitude of the loop transfer functions plotted so far are actually the square of the real amplitude. The problem comes from the way I treated data saved by the spectrum analyzer. Each file is composed of 3 columns: frequency, real part (a) and imaginary part (b) of the TF.  Of course amplitude and phase are recovered by doing:

Amplitude = sqrt (a^2 +b^2)

Phase = angle (a+i*b)

Due to an oversight, I had replaced the sqare root with the absolute value in the amplitude computation. This explain the unexpected behaviour (1/f^2 instead of 1/f) of the openloop TF around the UGF. 

We will upload soon new TFs measurements (taken by Yuefan and Marc on monday night) properly plotted.

R&D (FilterCavity)
Print this report.
YuefanGuo - 10:24, Thursday 20 July 2017 (535)Get code to link to this report
Mode cleaner test
After the installation of the MC, we started to test it with the green beam in order to make sure that the mechanical part works well.

Mode cleaner cavity consists of three mirrors, two of them are flat and one is curve. After the curve mirror there is the PZT to change the cavity length for finding a good mode matching. This piezo is connected to the output of PZT driver whose input is connected to a function generator to provide the scan signal.

Since we only want to do a simple test, so we did not use the telescope design but only one 200mm lens after the beam splitter, then two steering mirrors used to align the cavity, at the output of the MC, a PD with DC output is used to see the modes. The whole configuration shows in pic 1.

We used 25Hz ramp wave with amplitude of 1Vpp to scan the cavity. At the beginning, we only saw some fluctuation but no peaks. When we tried to make the output beam go straight, we were not able to do it.(Always cut by the mirror mount) So we removed the MC and aligned better from the lens, sent the beam after the mirror far enough to make sure it goes along the holes of table. When we put back the MC, we could see some higher modes at the output and also the curve mirror has some transmission beam this time. Put back the PD, we saw pic 2 on the oscilloscope. By checking the beam shape with the curve mirror transmission and the spectrum, we got better mode matching. In pic 3, the highest peak is TEM00, we also checked it by moving the voltage of the PZT driver by hand. I think this means the mechanical part of the MC works well, we are able to align the cavity with this design.
Images attached to this report
535_20170719102432_img4112.jpg 535_20170719102448_img4107.jpg 535_20170719102510_img4110.jpg
R&D (FilterCavity)
Print this report.
MarcEisenmann - 16:55, Wednesday 19 July 2017 (534)Get code to link to this report
Mode cleaner assembly
The assembly of the mode cleaner was finished last week.
A small problem was encounter : While screwing the cover part of the hole of cavity to the mode cleaner, a screw stayed stuck.
This was due to the fact that too long screw were proposed on the design. Instead of using M4*12, we used M4*8 screw for this part. We also used ethanol to avoid to stuck another screw.
Also, we couldn't find M3*16 screws so we used M3*15 screws.

To protect the wire used for the piezo power supply, we used a small piece of aluminum folded. One part is screwed to the optical bench while the other part hold a adaptor between BNC and the 2 wires for the piezo.

KAGRA MIR (Absorption)
Print this report.
ManuelMarchio - 13:38, Friday 14 July 2017 (532)Get code to link to this report
Comment to Noise investigation (Click here to view original report: 529)

The table is to be updated with the values of yesterday (in blue). 

  low probe power high probe power
signal AC 23mV AC 230mV→295mV
DC 440mV DC 5400mV→5200mV
AC/DC 0.052 AC/DC 0.043→0.057
noise
With sample
AC_rms 0.1mV AC_rms 2.8mV→1mV
DC 440mV DC 5400mV→5200mV
AC_rms/DC 2.30E-04 AC_rms/DC 4.5e-4→1.9e-4
ppm 884ppm ppm 2000ppm→667ppm
noise
Without sample
AC_rms 3μV AC_rms 70μV→ 200μV
DC 0.65V DC 6.5V
AC_rms/DC 4.60E-06 AC_rms/DC 1e-5→3e-5
ppm 18ppm ppm 46ppm→108ppm
R&D (FilterCavity)
Print this report.
MarcEisenmann - 10:52, Friday 14 July 2017 (531)Get code to link to this report
AOM characterization
AOM Characterization :

This week, in order to check the AOM characteristics, we install the AOM after a beam splitter on the green path. By using a beam splitter before the AOM and 2 powermeters ( 1 one reflexion, the other on the transmission at the output of the AOM ) and checking their ratio, we were able to characterize the AOM despite still having power fluctuations on the green beam. The optical setup used is described in an attached figure.

By changing the RF power send to the AOM, we were able to characterize the AOM 1st order with the use of a gaussian fit ( even if this wasn’t really a gaussian, it helped to locate the maximum) as following :

- Maximum efficiency : 73 % @ RF Power 28.4 dBm ( 692 mW)

The AOM test sheet said that we could expect a 1st order efficiency superior than 85% at 633 nm. In this case, our alignment was approximative as we wanted to check only the response of the AOM to different RF power.
Then we tried to put the AOM on the right position on the optical bench. As the AOM need a small input beam size, we put it in the middle of 2 lenses ( f = 100 mm ) .
At that position, we couldn't see anymore any diffraction order.

First, we checked the green Power Density sent to the AOM. We measure 10W/mm² when the AOM test sheet limit this power density to 2.5 W/mm². Hopefully, we reduced quickly (after few minutes) the laser power down to 2 W/mm². In regard to this, we contact AA Opto-Electronic, manufacturer of this AOM. Following their advice, we check that the crystal was still transparent without any visible damages.
Then, we tried to put the AOM back on the characterization position. We were able to see again diffraction orders. We realize again the characterization of the 1st order efficiency and obtain :

- Maximum efficiency : 69 % @ RF Power 28.3 dBm ( 676 mW) We expect that the difference might be due to misalignment.

After that, we checked the polarization of the green beam using a PBS because this AOM needs a vertical polarization to work. We found that in both positions the green beam has a vertical polarization as we expect.

The last difference is the divergence of the beam. Indeed the beam is really more diverging in the right position (5.6 mrad) than on the characterization position (1.6 mrad) compared to the diffraction angle (16.6 mrad).
To correct this problem we will try to change the lenses configuration in order to obtain a smaller divergence of the beam on the right AOM position.
Images attached to this report
531_20170714034932_aomcharacterizationefficiencyvsprfafterdamages.png 531_20170714034953_aomcharacterizationefficiencyvsprf.png 531_20170714035105_opticalscheme.png
KAGRA MIR (Absorption)
Print this report.
ManuelMarchio - 23:38, Thursday 13 July 2017 (529)Get code to link to this report
Noise investigation
 Members: Flaminio, Manuel, Kuroki
 
After aligning and getting the absorption signal from the reference samples, we investigated the noise in order to determine the sensitivity.
 
The noise was 70uV without the sample, the probe centered on the detector, the chopper rotating at 380Hz, and pump OFF. Quite higher than the specifications that say it should be 5-25uV.
 
We tried to find the source of the noise using a spectrum analyzer: replacing the chopper reference with the internal oscillator of the lock-in at 380Hz doesn't change the noise level, even turning off the chopper doesn't work. Noise doesn't change (see plots attached), so this excludes that the noise comes from the chopper vibrations.
 
(at some point the noise became huge, the order of many mV, like many spikes appearing randomly, it lasted for a couple of hours and then it stopped again, we have no clue where this came from, but it looks like what happened here)
 
We tried to change the PD power supply with the battery. We tried to shift the chopper frequency and we found a small peak at 384Hz, with this frequency also X and Y signals were not fluctuating around zero. So we decided to change the chopper frequency to 370Hz and that peak didn't shift. So, better not to use modulation frequency 384Hz.
 
We found out that the noise spectrum shape may depend on the centering of the probe on the detector.
Since the spot size at the detector is comparable with the filters holder in front of it, we decided to remove the filters and check the noise level.
 
We had the suspect that the PD saturates, so we put a ND filter (OD1) in front of the probe to reduce power and the following happened (without sample):
- The DC signal decreased from 6.5V to 1.1V
- The AC noise signal decreased from 70uV to 6uV
 
I made a scan of the surface reference sample, I attach the plots in the two cases: with the IR filter in front of the detector and without.
To check the noise I acquired 300s of data at the maximum of the scan absorption signal (z=35.1mm), with pump and without.
The pump power is 34mW
case std(AC) DC  std(AC/DC) AC  std(AC)  AC/DC std(AC/DC) std(ppm) std(ppm)
pump OFF OFF/ON OFF ON ON ON ON OFF ON
without IR filter 3.4uV 0.77V 4.4uV 0.042V 128uV 0.0545 1.67E-04 16 621
with IR filter 2.7uV 0.45V 6.1uV 0.024V 99.5uV 0.053 2.26E-04 23 873

We found out that the DC changes from 0.46V to 0.44V when switching off the pump. This happens only when there is the sample, this means that some pump is scattered from the sample.

We tried to put a diafragm in front of the detector just before the IR filters, in order to avoid part of the beam to reach the filters borders.
Placed a diafragm and close it as much as the DC signal doesn't change.
diafragm open: 1070ppm (maybe too early after switching on the pump)
diafragm closed: 800ppm
diafragm open again: 830ppm
diafragm closed again: 915ppm
This tells that clipping the beam with the diafragm doesn't clearly reduce the noise.
 
After placing the ND filter we checked the noise level with and without sample (case low probe power) and compared with the case without the ND filter (case high probe power). The following table summarizes the results.
 
  low probe power high probe power
signal AC 23mV AC 230mV
DC 440mV DC 5400mV
AC/DC 0.052 AC/DC 0.043
noise
With sample
AC_rms 0.1mV AC_rms 2.8mV
DC 440mV DC 5400mV
AC_rms/DC 2.30E-04 AC_rms/DC 4.50E-04
ppm 884ppm ppm 2000ppm
noise
Without sample
AC_rms 3μV AC_rms 70μV
DC 0.65V DC 6.5V
AC_rms/DC 4.60E-06 AC_rms/DC 1.00E-05
ppm 18ppm ppm 46ppm

Today we checked again the signal level at the above conditions and we found almost the same values of the table above but the AC noise with low probe power and without sample was higher: around 200 μV instead of 70μV.

Then Kuroki suggested to cover the Imaging Unit to protect from wind (as it was in the original setup last year) and the noise became between 50-100μV , then we removed the cover and the noise remained on the same level 50-100μV. We think we should cover better the optical parts, in order to avoid temperature fluctuations which might affect the noise.

Images attached to this report
529_20170713151019_choppernoise.png 529_20170713151320_diafragmnoise.png 529_20170713152413_withirfilters.png 529_20170713152418_withoutirfilters.png
Comments related to this report
ManuelMarchio - 13:38, Friday 14 July 2017 (532)

The table is to be updated with the values of yesterday (in blue). 

  low probe power high probe power
signal AC 23mV AC 230mV→295mV
DC 440mV DC 5400mV→5200mV
AC/DC 0.052 AC/DC 0.043→0.057
noise
With sample
AC_rms 0.1mV AC_rms 2.8mV→1mV
DC 440mV DC 5400mV→5200mV
AC_rms/DC 2.30E-04 AC_rms/DC 4.5e-4→1.9e-4
ppm 884ppm ppm 2000ppm→667ppm
noise
Without sample
AC_rms 3μV AC_rms 70μV→ 200μV
DC 0.65V DC 6.5V
AC_rms/DC 4.60E-06 AC_rms/DC 1e-5→3e-5
ppm 18ppm ppm 46ppm→108ppm
R&D (FilterCavity)
Print this report.
YuefanGuo - 18:26, Thursday 13 July 2017 (530)Get code to link to this report
End bench installation and progress in AOM
Last week, when we tried to superpose the infrared and green beam on the bench, we just put a CCD camera on the transmission of the dichroic mirror. Since the green power is larger and easier to see, so there are much stronger green power in the infrared path, which is not useful anymore after we align the beam well. So yesterday we put a mirror which can reflect green at 45 degree before the CCD camera to remove it. The original plan is to put another beam splitter after this mirror to separate the beam into two, one for CCD, the other for PSD, the same as the green path. But after I tried to put the beam splitter, I cannot see any infrared both in the reflection and transmission with the CCD. So we gave up with this idea and just stopped with the mirror installed.

We tried to calibrate the AOM again. Since the PD has too much effect on the power fluctuation, we decided to put two power meter in 0 and 1st order, so when we change the RF power, we can see the difference between these two orders. But we cannot find a good position to put the power meter that two order is separated enough and also the beam size is smaller than the aperture of the power meter. So we put another beam splitter after the MZ BS, and two power meter on two path of this beam splitter. Then with spectrum analyzer, we did the ratio between these two power in time domain to see the real change effected by the RF power.
R&D (FilterCavity)
Print this report.
EleonoraCapocasa - 16:02, Monday 10 July 2017 (412)Get code to link to this report
Filter cavity locking loop characterization

In the past days we tried to characterize the locking loop of the filter.

The loop transfer function for the filter cavity (sketched in figure1) is compose by different blocks

  • G1 [Hz/V]  = piezo actuator                      
  • G2 [Hz/Hz]  = SHG                                  
  • G3 [Hz/W]  = cavity
  • G4 [W/V]  = photodiode + demodulation
  • H [V/V]= servo 
 
if we define G = G1*G2*G3*G4  the open loop trasfer function is simply  H*G
 
In the loop scheme are shown the points where we can read the signal and the points when we can inject noise. By choosing the appropriate combination of observation and injection points we have tried to measure different parts of the loop transfer function. In particular
 
1)      H*G   ->  OPEN LOOP TF
  • inject noise on perturb 
  • measure EPS1/EPS2
NOTE:  We perform this measurement with a swept sign. (See picture 2) It allows to measure the UGF and the phase margin. The measure is not good at low frequency where the gain on the loop is higher. Unfortunately at these frequency where are not able to inject enough noise to dominate the error signal without unlocking.
 
2)       H   -> ELECTRONIC TF
  • inject noise on perturb
  • measure piezo mon/EPS2
NOTE: We performed the measure with a swept sine (See picture 3). Unfortunately I was not able to find a way to monitor the coherence between the two channels while performing a swept sine, so I don't know how much we can trust the measurement. It seems to be flat after the cavity pole (1.5 kHz) as it should be.
We have also perform the TF without injecting additional noise and assuming that the laser was sufficiently high. A result of the measure is plot in figure 4. I have also measures the coherence between the two channels ( shown in picture 5) which shoud tell in which regions the measuremts is more reliable.
 
3)         G  
  • inject noise on RAMP
  • measure  EPS2/piezo mon
NOTE: The blocks composing G are basically frequency independent up to few tens of KHz except for the cavity which should have a pole at 1.45 KHz.
Being able to fit the pole frequency would allow a measurement of the cavity finesse [ f_p = c/( 4*L*F)]
Also in this case, the amount of noise we could inject without unlocking was not high enough to provide a clear measurement ( we tried with with noise and swept sign). The obtained TF is shown in picture 6. it is not possible to extrapolate a value for the cavity pole.
 
In the last picture there is a scheme of the rampeauto done by Pierre prat with a summary of the gain of each channel.
Images attached to this report
412_20170710084417_07.png 412_20170710084439_tfopenloop.png 412_20170710084502_31.png 412_20170710084517_04.png 412_20170710084529_cohe.png 412_20170710084628_27.png 412_20170710084706_rampeautosummary.jpg
Comments related to this report
EleonoraCapocasa - 07:43, Wednesday 26 July 2017 (536)

The amplitude of the loop transfer functions plotted so far are actually the square of the real amplitude. The problem comes from the way I treated data saved by the spectrum analyzer. Each file is composed of 3 columns: frequency, real part (a) and imaginary part (b) of the TF.  Of course amplitude and phase are recovered by doing:

Amplitude = sqrt (a^2 +b^2)

Phase = angle (a+i*b)

Due to an oversight, I had replaced the sqare root with the absolute value in the amplitude computation. This explain the unexpected behaviour (1/f^2 instead of 1/f) of the openloop TF around the UGF. 

We will upload soon new TFs measurements (taken by Yuefan and Marc on monday night) properly plotted.

R&D (FilterCavity)
Print this report.
EleonoraCapocasa - 15:02, Monday 10 July 2017 (428)Get code to link to this report
Occasional excess of noise in local controls

The activity of locking characterization of the past days pointed out some issues that are worth to be reported.

As expected the stability of the lock is strongly affected by the performance of local controls. The occasional presence of spikes or excess of noise has been observed on the local controls of BS, PR and INPUT mirror.
 
In the following table I report the normal angular variation for each suspension that can be used as reference values to detect excess of noise. 
 
  open loop (urad) closed loop (urad)
PR yaw 1-2 0.5-1
PR pitch 4-8 2-3
BS yaw 3-4 2-3
BS pitch 5-6 4-5
INPUT yaw        2-3 1-2
INPUT pitch 4-5 3-4
END yaw 2-3 1-2
END pitch 4-5 3-4
 
The value of the angular variation in micro radiant is reported on the top of each error signal plot in the labview control VIs and it is computed measuring the difference between the maximum and the minimum of the error signal over a second and multiplied it by the respective calibration. 
 
PR
We observed spikes on pitch and yaw signal on the morning of the 28th june for the first time.  Since this spikes where also present when disconnecting the signal in input to the ADC we suspecting the ADC itself or the softwere. We changed the ADC with a spare one from the labview control of the west arm without notice any improvement. ( We put back the original one.)
The spikes has disappeared the day after and I have never observed them again.
 
BS
Similar kinds of spikes are are sometimes appearing (bringing the motion up to 15-20 urad). They disappear when I disconnect the input cableto the ADC and are not present on PR signals which is using the same ADC. Maybe they are not coming from the electronics.
 
INPUT 
Excess of noise can be observed periodically. It bring the mirror motion up to 20-30 urad making impossible to keep a proper alignment. I have observed that they disappear switching on and off the  laser of the INPUT local control. I have changed the laser power supply but it didn’t solve the problem.
 
END
Nothing to report
 
My statistics is too small to extrapolate a trend for these noise occurrences but if you spend few hours working on the locking you are likely to have some noisy periods of BS and or INPUT. 
 
Investigation on the origin on the issue should be done in order to fix it. The possibility to record and store long periods of data will help this.
R&D (FilterCavity)
Print this report.
EleonoraCapocasa - 01:46, Saturday 08 July 2017 (429)Get code to link to this report
IR and green beam simultaneously aligned in the cavity

After a long alignment work we were able to make the IR and the green beam flashing in the cavity at the same time. In this video are shown superposed flashes in trasmission both of the green and the IR (the green beam as been cut at the second 5).

In this configuration we were able to lock the cavity on the green TEM00 but we coudn't check the IR condition since there was too much green light transmitted by the dichroic mirror before the camera installed on the end bench. 

After solving this issue and installing the AOM we will start to look for the frequency shift needed to have both the IR and the green resonant on the fundamental mode.

R&D (FilterCavity)
Print this report.
YuefanGuo - 15:50, Friday 07 July 2017 (526)Get code to link to this report
AOM calibration and green power fluctuation
We tried to calibrate the AOM on the mode cleaner path. With a 100mm lens to focus the beam, followed the operation manual. At first, we put the AOM around the beam waist position and adjusted the beam position at the input and output port to have the highest transmission rate before we powered it up. And also we set the position of the beam on the screen we put as close as we can from the bench edge, so this will be our 0 order position.

Then we powered up the AOM, there was the other orders appearing, the one close to the 0 order is the 1st order which we need. We put a PD at the 1st order, connected it to the oscilloscope and started to turn the AOM to have maximum power in the 1st order. After finding the best position of the AOM, we tried to change the RF power we were sending to increase the power more. But when we tried to do this, we found out the power fluctuation is about 40-50% percent, it was much more than the tolerance.

We put PD both in the infrared path and the green path to check the fluctuation of the green is coming from the infrared or not. Then we found out since the PD aperture is quite small, so it will increase the degree of uncertainty we saw. So we changed the PD to the powermeter which has larger aperture. This time the infrared is quite stable and the green is fluctuating but much less than before. We guessed that the fluctuation of the green is coming from the changing of the SHG cavity alignment when people moving around or touching the bench. We are going the install the MZ and stabilize the green.

Then other thing we checked is that the SHG loop gain we are using now is 50. But with this gain,if we changed the power sent to the PZT, the cavity cannot pull the error signal back to zero when the cavity is locked. If we increase the gain, until it reaches 10000, there will be no oscillation appear, the cavity will be locked more stable, but one problem is that it will be quite easy also lock on the other mode. We will try to find a the optimal gain considering also the filter cavity.

KAGRA MIR (Absorption)
Print this report.
ManuelMarchio - 16:27, Thursday 06 July 2017 (525)Get code to link to this report
Status report

- In order to increase the pump power safely, we cover the laser path with aluminum black walls and black paper. 

- We also cover the probe part in order to stop air flow from hepa filters which is a possible noise source. Kuroki-san helped me on this tasks.

- I put a small translation stage below the half ball in the imaging unit in order to adjust better the alignment and I tried many times the alignment until I found a good signal for the surface reference sample, comparable with the one of last year. Also the bulk reference sample gives almost the same signal as last year.

- The parts for the 1310nm probe laser were delivered, I glued the golden prism mirror on a half inch post, I'm waiting for the glue to cure under the neon lamps

Images attached to this report
525_20170705145827_surf.png 525_20170705145831_bulk.png 525_20170706092407_screenshotfrom20170706162334.png 525_20170706092418_screenshotfrom20170706162152.png 525_20170706092431_screenshotfrom20170706162120.png 525_20170706092439_screenshotfrom20170706162057.png 525_20170706092449_screenshotfrom20170706162018.png
R&D (FilterCavity)
Print this report.
YuefanGuo - 12:02, Tuesday 04 July 2017 (524)Get code to link to this report
Analog signal receiver changed
Yesterday we found out the analog signal sent through the fiber from the end room had some problem. No matter what signal we sent, it was always -7.5V. At first we thought maybe the problem was from the fiber, so we decided to change the fiber, but the receiver(pic 1) we are using now have a special port, other fibers cannot be used. Other possibility is the receiver or the transmitter had some problem, so we took the transmitter from the west end to the south end. Sent a signal from the west end transmitter, the original fiber and the south end receiver, with this configuration we have a offset about 70mV. So we also changed the receiver to the west end receiver, now everything is fine.
Images attached to this report
524_20170704050057_img3899.jpg
DECIGO (General)
Print this report.
EleonoraCapocasa - 00:50, Tuesday 04 July 2017 (523)Get code to link to this report
Comment to FIlter cavity experiment: Offset in the filter cavity reflected signal (Click here to view original report: 521)
[I report about the investigations done by Pierre Prat about the offset in the error signal]
 
The mixers ideally have a zero offset when the LO and RF signals are in quadrature, if it is not exactly the case, they can have an offset that can be a few mV, varying with the frequency of LO.
 
We saw this afternoon that the 1.9 MHz low-pass filter (LBP1.9) was not terminated by a 50 Ohms as it should be. We had an offset of the order of 200mV on the output monitor EPS1. By charging the filter with a 50 Ohm load, the offset reduced to 50mV at the EPS1 output.
 
Between input DETECT F (error signal) and outputs EPS1/EPS2 (error monitors) there is a fixed gain (independent of the attenuation) of 15.9.  See attached picture.
 
The offset at the output of the mixer (measured with the oscillloscope) is therefore about 3mV, which is normal. 
 
Pierre has verified that, once the filter BLP1.9 is loaded by 50 Ohm, this offset is stable and does not depend on the ground conditions. 
Images attached to this comment
523_20170703174745_signal.png
R&D (FilterCavity)
Print this report.
Matteo Barsuglia and Eleonora Capocasa - 22:51, Sunday 02 July 2017 (522)Get code to link to this report
Calibration of the PDH error signal

The PDH filter cavity signal has been calibrated injecting a line at 28 kHz (above the ugf ~ 10 kHz of the loop) on the “ramp” input of the electronic servo. The ramp input is summed to the PZT correction signal.

The amplitude of the 28 kHz line in Hz is obtained using the formula:

S_Hz = V_RMS  (V) * sqrt(2)*100*2e6 Hz/V = 1.25e-6*sqrt(2)*100*2e6 = 353 Hz 

Where V_RMS is the line amplitude measured by the Agilent spectrum analyser. The factor sqrt(2) is obtained to pass from the V_RMS to the line amplitude (the factor has been also experimentally verified looking the same line with the spectrum analyser and the oscilloscope).

The factor 100 is the reduction of the PZT_moni output . 2e6 Hz/V is the calibration of the PZT after the SHG.

Measuring the line at 28 kHz in the error signal and compensating for the cavity frequency pole is it possible to find the calibration factor K in V/Hz. The formula used is :

S_V  = K(V/Hz)* S_Hz /sqrt(1+ (f/f_0)^2)  

where f_0 = 1.5 kHz and S_V = sqrt(2)*38.9e-3 V 

--> K = 2.9e-3 V/Hz

which seems to be in agreement with the calibration obtained looking the PDH signal when the cavity is freely swinging. In that case we see a peak-to-peak of the PDH of ~ 4 V for 1.5 kHz of the cavity line which correspond to a K = 2.7e-3 V/Hz. Note that when the cavity is freely swining we have also rining effects which can perturb this measurement. 

We have also checked that reducing the frequency of the line sent to the PZT (with the same amplitude) to 14 kHz, the amplitude of the line of the error signal is multiplied by 2, as expected given the cavity pole. A more quantitative analysis (fully taking in account the effect of the loop) is necessary to check the position of the cavity pole.

Another test was to increase the amplitude of the line by a factor 10, thus having a 29 kHz line with amplitude of 3 kHz (two times the cavity width of the cavity). The cavity stays locked and the calibration factor measured is the same with the one measured with the line with an amplitude of 300 Hz. Increasing further the amplitude of the 28 kHz line to ~ 7 kHz (4 times the cavity linewidth) makes the lock more fragile, and sometimes the cavity unlocks. Moreover, an oscillation with a frequency of ~ 1 Hz appears in the error signal (but it is not accompanied with a similar oscillation in the transmitted power).